- Recombinant Bovine Transmembrane protein 223 (TMEM223)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1024065
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 21,992 Da
- E Coli or Yeast
- Transmembrane protein 223 (TMEM223)
- 1-202
- transmembrane protein 223
Sequence
MAAPGRRWSVLLFRALQSLSARRALHDTAPPRDVLLFEHERGRFFAVLGLFCAGQGVFWASLAIASLARPPTPVRPTDAKTPDHGGLDLRSTLWRYGLAVGCGAIGSLVLGAGLLFSLRSVRSVMLRAGGKQVTLTTHAPFGWGAHFTVPLNQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKAGHFPNTKLFDNTVGAYRSL